KRAS Antibody - N-terminal region : HRP

KRAS Antibody - N-terminal region : HRP
SKU
AVIARP55408_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KRAS

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GTPase NRas

Protein Size: 189

Purification: Affinity Purified

Specificity#: 100% homologous to human KRAS, NRAS and HRAS.
More Information
SKU AVIARP55408_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55408_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3845
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×