LACTB2 Antibody - middle region : FITC

LACTB2 Antibody - middle region : FITC
SKU
AVIARP56810_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of LACTB2 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LACTB2

Key Reference: Suzuki,Y., Gene 200 (1-2), 149-156 (1997)

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beta-lactamase-like protein 2

Protein Size: 288

Purification: Affinity Purified
More Information
SKU AVIARP56810_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56810_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51110
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×