Anti-LAMTOR2

late endosomal/lysosomal adaptor, MAPK and MTOR activator 2, Polyclonal, IgG, Rabbit

Sequence: RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP

GeneName: LAMTOR2

Ensembl Gene ID: ENSG00000116586

UniProt ID: Q9Y2Q5

Entrez Gene ID: 28956

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.2

Interspecies Mouse/Rat: ENSRNOG00000019908: 99%, ENSMUSG00000028062: 99%

Enhanced Validation: No

• SKU: ATLHPA004126-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA004126-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 28956
• Host: Rabbit
• Conjugate: Unconjugated