LCK Antibody - N-terminal region : Biotin

LCK Antibody - N-terminal region : Biotin
SKU
AVIARP54525_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: LCK is a member of the Src family of protein tyrosine kinases (PTKs). It is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. LCK localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules.This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCK

Key Reference: Merino,E., (2008) J. Immunol. 180 (9), 5805-5815

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: PSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tyrosine-protein kinase Lck

Protein Size: 509

Purification: Affinity Purified
More Information
SKU AVIARP54525_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54525_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3932
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×