LCN1 Antibody - middle region : HRP

LCN1 Antibody - middle region : HRP
SKU
AVIARP54685_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LCN1

Key Reference: Yusifov,T.N., (er) Mol. Vis. 14, 180-188 (2008)

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Lipocalin-1

Protein Size: 176

Purification: Affinity Purified
More Information
SKU AVIARP54685_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54685_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3933
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×