Ldha Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Ldha mRNA expression in fibroblasts increases in response to induction by epidermal growth factor or serum.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Ldha

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: LVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: L-lactate dehydrogenase A chain

Protein Size: 332

Purification: Affinity Purified

• SKU: AVIARP53601_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53601_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 24533
• Host: Rabbit
• Conjugate: Conjugated, Biotin