LDHA Antibody - middle region : HRP

LDHA Antibody - middle region : HRP
SKU
AVIARP54777_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LDHA

Key Reference: Listerman,I., PLoS Genet. 3 (11), E212 (2007)

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: L-lactate dehydrogenase A chain

Protein Size: 332

Purification: Affinity Purified
More Information
SKU AVIARP54777_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54777_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 3939
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×