LDHAL6B Antibody - middle region : Biotin

LDHAL6B Antibody - middle region : Biotin
SKU
AVIARP53813_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LDHAL6B

Key Reference: Pioli,P.A., (2002) J. Biol. Chem. 277 (38), 35738-35745

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: L-lactate dehydrogenase A-like 6B

Protein Size: 381

Purification: Affinity Purified
More Information
SKU AVIARP53813_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53813_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 92483
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×