LDHAL6B Antibody - middle region : HRP

LDHAL6B Antibody - middle region : HRP
SKU
AVIARP53813_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LDHAL6B

Key Reference: Pioli,P.A., (2002) J. Biol. Chem. 277 (38), 35738-35745

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: L-lactate dehydrogenase A-like 6B

Protein Size: 381

Purification: Affinity Purified
More Information
SKU AVIARP53813_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53813_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 92483
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×