LDHC Antibody - middle region : Biotin

LDHC Antibody - middle region : Biotin
SKU
AVIARP53602_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LDHC

Key Reference: Sharma,P.R., (2007) Clin. Biochem. 40 (18), 1414-1419

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: L-lactate dehydrogenase C chain

Protein Size: 332

Purification: Affinity Purified
More Information
SKU AVIARP53602_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53602_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3948
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×