LEMD2 Antibody - middle region : HRP

LEMD2 Antibody - middle region : HRP
SKU
AVIARP55792_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LEMD2 is involved in nuclear structure organization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LEMD2

Key Reference: Otsuki,T., (2005) DNA Res. 12 (2), 117-126

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: LEM domain-containing protein 2

Protein Size: 503

Purification: Affinity Purified
More Information
SKU AVIARP55792_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55792_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221496
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×