LGALS8 Antibody - C-terminal region : FITC

LGALS8 Antibody - C-terminal region : FITC
SKU
AVIARP53656_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LGALS8

Key Reference: Yamamoto,H., (2008) J. Biochem. 143 (3), 311-324

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: galectin-8

Protein Size: 359

Purification: Affinity Purified
More Information
SKU AVIARP53656_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53656_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3964
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×