LGALS9 Antibody - middle region : FITC

LGALS9 Antibody - middle region : FITC
SKU
AVIARP54821_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LGALS9

Key Reference: Bi,S., (2008) J. Biol. Chem. 283 (18), 12248-12258

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: galectin-9

Protein Size: 355

Purification: Affinity Purified
More Information
SKU AVIARP54821_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54821_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3965
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×