Lhpp Antibody - C-terminal region : Biotin

Lhpp Antibody - C-terminal region : Biotin
SKU
AVIARP57606_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Lhpp is a phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. It has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Lhpp

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: VGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phospholysine phosphohistidine inorganic pyrophosphate phosphatase

Protein Size: 270

Purification: Affinity Purified
More Information
SKU AVIARP57606_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57606_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 76429
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×