LIN37 Antibody - middle region : Biotin

LIN37 Antibody - middle region : Biotin
SKU
AVIARP57335_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein expressed in the eye.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LIN37

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein lin-37 homolog

Protein Size: 246

Purification: Affinity Purified
More Information
SKU AVIARP57335_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57335_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55957
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×