LOH11CR2A Antibody - N-terminal region : HRP

LOH11CR2A Antibody - N-terminal region : HRP
SKU
AVIARP55093_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LOH11CR2A may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOH11CR2A

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: TLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: von Willebrand factor A domain-containing protein 5A

Protein Size: 786

Purification: Affinity Purified
More Information
SKU AVIARP55093_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55093_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4013
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×