LPIN1 Antibody - N-terminal region : FITC

LPIN1 Antibody - N-terminal region : FITC
SKU
AVIARP53826_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LPIN1

Key Reference: Ong,K.L., (2008) Am. J. Hypertens. 21 (5), 539-545

Molecular Weight: 98kDa

Peptide Sequence: Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidate phosphatase LPIN1

Protein Size: 890

Purification: Affinity Purified
More Information
SKU AVIARP53826_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53826_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 23175
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×