LPP Antibody - N-terminal region : Biotin

LPP Antibody - N-terminal region : Biotin
SKU
AVIARP53640_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LPP

Key Reference: Jin,L., (2007) Circ. Res. 100 (6), 817-825

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lipoma-preferred partner

Protein Size: 612

Purification: Affinity Purified
More Information
SKU AVIARP53640_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53640_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4026
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×