LRRC18 Antibody - N-terminal region : HRP

LRRC18 Antibody - N-terminal region : HRP
SKU
AVIARP56171_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LRRC18 may be involved in the regulation of spermatogenesis and sperm maturation.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LRRC18

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: NLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leucine-rich repeat-containing protein 18

Protein Size: 255

Purification: Affinity Purified
More Information
SKU AVIARP56171_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56171_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 474354
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×