LRRC23 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC23

Key Reference: Tasheva,E.S., (er) Mol. Vis. 11, 452-460 (2005)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 23

Protein Size: 343

Purification: Affinity Purified

• SKU: AVIARP53486_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53486_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10233
• Host: Rabbit
• Conjugate: Conjugated, Biotin