LRRC23 Antibody - N-terminal region : FITC

LRRC23 Antibody - N-terminal region : FITC
SKU
AVIARP53486_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC23

Key Reference: Tasheva,E.S., (er) Mol. Vis. 11, 452-460 (2005)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 23

Protein Size: 343

Purification: Affinity Purified
More Information
SKU AVIARP53486_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53486_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10233
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×