LRRC56 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: LRRC56 contains 3 LRR (leucine-rich) repeats. The exact function of LRRC56 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC56

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 56

Protein Size: 542

Purification: Affinity Purified

• SKU: AVIARP53452_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53452_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 115399
• Host: Rabbit
• Conjugate: Conjugated, Biotin