LRRTM1 Antibody - middle region : FITC

LRRTM1 Antibody - middle region : FITC
SKU
AVIARP55787_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRTM1

Key Reference: Francks,C., (2007) Mol. Psychiatry 12 (12), 1129-1139

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat transmembrane neuronal protein 1

Protein Size: 522

Purification: Affinity Purified
More Information
SKU AVIARP55787_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55787_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 347730
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×