LRWD1 Antibody - middle region : Biotin

LRWD1 Antibody - middle region : Biotin
SKU
AVIARP55558_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of RAT LOC304396

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: EPLHFLQCHSRNNSPKDLETQLWACAFEPAREEGHSGATSQTVATCGGEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: leucine-rich repeat and WD repeat-containing protein 1

Protein Size: 416

Purification: Affinity Purified
More Information
SKU AVIARP55558_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55558_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 304396
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×