LSM14A Antibody - C-terminal region : FITC

LSM14A Antibody - C-terminal region : FITC
SKU
AVIARP55289_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LSM14A

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein LSM14 homolog A

Protein Size: 463

Purification: Affinity Purified
More Information
SKU AVIARP55289_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55289_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 26065
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×