LTA4H Antibody - middle region : Biotin

LTA4H Antibody - middle region : Biotin
SKU
AVIARP54368_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LTA4H

Key Reference: Bevan,S., (2008) Stroke 39 (4), 1109-1114

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leukotriene A-4 hydrolase

Protein Size: 611

Purification: Affinity Purified
More Information
SKU AVIARP54368_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54368_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4048
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×