LYPD5 Antibody - N-terminal region : HRP

LYPD5 Antibody - N-terminal region : HRP
SKU
AVIARP55826_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYPD5

Key Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ly6/PLAUR domain-containing protein 5

Protein Size: 208

Purification: Affinity Purified
More Information
SKU AVIARP55826_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55826_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 284348
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×