LYPD6 Antibody - C-terminal region : Biotin

LYPD6 Antibody - C-terminal region : Biotin
SKU
AVIARP53450_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Members of the LY6 protein family (see SLURP1; MIM 606119), such as LYPD6, have at least one 80-amino acid LU domain that contains 10 conserved cysteines with a defined disulfide-bonding pattern.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LYPD6

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: KAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ly6/PLAUR domain-containing protein 6

Protein Size: 76

Purification: Affinity Purified
More Information
SKU AVIARP53450_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53450_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 130574
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×