LYPD6 Antibody - middle region : FITC

LYPD6 Antibody - middle region : FITC
SKU
AVIARP53451_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYPD6

Key Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ly6/PLAUR domain-containing protein 6

Protein Size: 171

Purification: Affinity Purified
More Information
SKU AVIARP53451_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53451_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 130574
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×