Lyrm4 Antibody - middle region : HRP

Lyrm4 Antibody - middle region : HRP
SKU
AVIARP57407_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Lyrm4 is required for nuclear and mitochondrial iron-sulfur protein biosynthesis.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: LYR motif-containing protein 4

Protein Size: 91

Purification: Affinity Purified
More Information
SKU AVIARP57407_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57407_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 380840
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×