LYSMD2 Antibody - middle region : Biotin

LYSMD2 Antibody - middle region : Biotin
SKU
AVIARP55592_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYSMD2

Key Reference: Rush,J., (2005) Nat. Biotechnol. 23 (1), 94-101

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LysM and putative peptidoglycan-binding domain-containing protein 2

Protein Size: 215

Purification: Affinity Purified
More Information
SKU AVIARP55592_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55592_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 256586
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×