MAB21L1 Antibody - N-terminal region : FITC

MAB21L1 Antibody - N-terminal region : FITC
SKU
AVIARP54782_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders.This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders. There is evidence that this gene has 2 transcripts with alternate polyA sites, but the full length nature of the longer transcript has not been defined. Sequence Note: The sequence U38810.1 is a chimeric mRNA clone. Only the mab-21-like protein 1 region was propagated into this RefSeq record.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAB21L1

Key Reference: Smith,M., (2002) Cytogenet. Genome Res. 98 (4), 233-239

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein mab-21-like 1

Protein Size: 359

Purification: Affinity Purified
More Information
SKU AVIARP54782_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54782_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4081
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×