MAGEA4 Antibody - C-terminal region : HRP

MAGEA4 Antibody - C-terminal region : HRP
SKU
AVIARP54410_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MAGEA4 is a member of the MAGEA family. The members of this family are proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. At least four variants encoding the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAGEA4

Key Reference: Ries,J., (2008) J. Oral Pathol. Med. 37 (2), 88-93

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Melanoma-associated antigen 4

Protein Size: 317

Purification: Affinity Purified
More Information
SKU AVIARP54410_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54410_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4103
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×