Mapk11 Antibody - N-terminal region : Biotin

Mapk11 Antibody - N-terminal region : Biotin
SKU
AVIARP56438_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Mapk11

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: VPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Mapk11 Ensembl ENSRNOP00000009325

Protein Size: 364

Purification: Affinity Purified
More Information
SKU AVIARP56438_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56438_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 689314
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×