MAPK11 Antibody - N-terminal region : HRP

MAPK11 Antibody - N-terminal region : HRP
SKU
AVIARP56437_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The encoded protein can be activated by proinflammatory cytokines and environmental stresses through phosphorylation by mitogen activated protein kinase kinases (MKKs). Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MK11

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: mitogen-activated protein kinase 11

Protein Size: 364

Purification: Affinity Purified
More Information
SKU AVIARP56437_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56437_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5600
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×