MAPK13 Antibody - middle region : HRP

MAPK13 Antibody - middle region : HRP
SKU
AVIARP56440_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK13

Key Reference: Zhou,X., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5620-5625

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitogen-activated protein kinase 13

Protein Size: 365

Purification: Affinity Purified
More Information
SKU AVIARP56440_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56440_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5603
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×