MARK3 Antibody - middle region : Biotin

MARK3 Antibody - middle region : Biotin
SKU
AVIARP56343_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: MARK3 is involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MARK3

Key Reference: Murphy,J.M., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (36), 14336-14341

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAP/microtubule affinity-regulating kinase 3

Protein Size: 729

Purification: Affinity Purified
More Information
SKU AVIARP56343_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56343_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4140
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×