MED19 Antibody - middle region : FITC

MED19 Antibody - middle region : FITC
SKU
AVIARP55596_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II .

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MED19

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 19

Protein Size: 244

Purification: Affinity Purified
More Information
SKU AVIARP55596_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55596_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 219541
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×