Med31 Antibody - C-terminal region : Biotin

Med31 Antibody - C-terminal region : Biotin
SKU
AVIARP56821_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Med31

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: YEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNTTAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription, subunit 31 homolog (Yeast) (Predicted) EMBL EDM05096.1

Protein Size: 131

Purification: Affinity Purified

Subunit: 31
More Information
SKU AVIARP56821_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56821_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 287475
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×