Melanostatin (frog, eel) (trifluoroacetate salt)

Shelf life (days): 1460.0

Formulation: A solid

Formal Name: 19-L-lysine-neuropeptide Y (human), trifluoroacetate salt

Amino Acids: YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY-NH2

Purity: ≥95%

Formula Markup: C189H285N53O57S / XCF3COOH

Formula Weight: 4243.7

Notes: Melanostatin is an endogenous peptide.{51903,24276} It is formed from pro-neuropeptide Y when pro-neuropeptide Y is cleaved into melanostatin and C-flanking peptide of neuropeptide Y (NPY).{24276} Melanostatin inhibits α-melanocyte-stimulating hormone (α-MSH) release from primary frog neurointermediate lobes (NILs; ED50 = 100 nM).{51903} It inhibits thyrotropin-releasing hormone-induced increases in intracellular calcium in primary frog melanotrope cells when used at a concentration of 100 nM. Intracerebroventricular administration of melanostatin (5 or 10 nmol/kg) increases food intake in frog larvae.{51904} It increases mean blood pressure in normotensive sharks when administered at a dose of 5 nmol/kg.{51905}

• SKU: CAY41461-1
• Manufacturer: Cayman Chemical
• Manufacturer SKU: 41461-1
• Package Unit: 1 mg
• Quantity Unit: STK