METAP1 Antibody - N-terminal region : Biotin

METAP1 Antibody - N-terminal region : Biotin
SKU
AVIARP55179_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: METAP1 removes the amino-terminal methionine from nascent proteins. METAP1 is required for normal progression through the cell cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human METAP1

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methionine aminopeptidase 1

Protein Size: 386

Purification: Affinity Purified
More Information
SKU AVIARP55179_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55179_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23173
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×