METTL5 Antibody - N-terminal region : HRP

METTL5 Antibody - N-terminal region : HRP
SKU
AVIARP54982_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: METTL5 is a probable methyltransferase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human METTL5

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: IAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Methyltransferase-like protein 5

Protein Size: 209

Purification: Affinity Purified
More Information
SKU AVIARP54982_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54982_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 29081
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×