MFAP1 Antibody - middle region : HRP

MFAP1 Antibody - middle region : HRP
SKU
AVIARP56655_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MFAP1 is a component of the elastin-associated microfibrils.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MFAP1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Microfibrillar-associated protein 1

Protein Size: 439

Purification: Affinity Purified
More Information
SKU AVIARP56655_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56655_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4236
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×