MFN1 Antibody - middle region : Biotin

MFN1 Antibody - middle region : Biotin
SKU
AVIARP57702_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MFN1

Molecular Weight: 84

Peptide Sequence: Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitofusin-1

Protein Size: 741

Purification: Affinity Purified
More Information
SKU AVIARP57702_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57702_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55669
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×