MFSD8 Antibody - middle region : Biotin

MFSD8 Antibody - middle region : Biotin
SKU
AVIARP55547_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The protein likely localizes to lysosomal membranes. Mutations in this gene are correlated with a variant form of late infantile-onset neuronal ceroid lipofuscinoses (vLINCL).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MFSD8

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: FFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Major facilitator superfamily domain-containing protein 8

Protein Size: 518

Purification: Affinity Purified
More Information
SKU AVIARP55547_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55547_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 256471
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×