MGAT4D Antibody - middle region : Biotin

MGAT4D Antibody - middle region : Biotin
SKU
AVIARP56050_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC152586

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: KPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQYKPSLFQHVGIHSSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4D

Protein Size: 166

Purification: Affinity Purified
More Information
SKU AVIARP56050_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56050_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 152586
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×