MGC45491 Antibody - middle region : HRP

MGC45491 Antibody - middle region : HRP
SKU
AVIARP55574_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of MGC45491 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGC45491

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: CRPLRPLLGFRESDSAKPASLRLLQHTPSARRNYRIAGARLMRSNYPPPL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C6orf223

Protein Size: 242

Purification: Affinity Purified
More Information
SKU AVIARP55574_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55574_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221416
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×