MID2 Antibody - C-terminal region : FITC

MID2 Antibody - C-terminal region : FITC
SKU
AVIARP57854_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to microtubular structures in the cytoplasm. Alternate splicing of this gene results in two transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MID2

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: WGLWPEIRKCKEAVSCSRLAGAPRGLYNSVDSWMIVPNIKQNHYTVHGLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable E3 ubiquitin-protein ligase MID2

Protein Size: 735

Purification: Affinity Purified
More Information
SKU AVIARP57854_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57854_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 11043
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×