MIER2 Antibody - middle region : Biotin

MIER2 Antibody - middle region : Biotin
SKU
AVIARP56974_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: MIER2 is a transcriptional repressor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MIER2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: ETVAPAQVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mesoderm induction early response protein 2

Protein Size: 545

Purification: Affinity Purified
More Information
SKU AVIARP56974_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56974_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54531
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×