MIER2 Antibody - middle region : HRP

MIER2 Antibody - middle region : HRP
SKU
AVIARP56973_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MIER2 is a transcriptional repressor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MIER2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mesoderm induction early response protein 2

Protein Size: 545

Purification: Affinity Purified
More Information
SKU AVIARP56973_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56973_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54531
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×